Polyclonal Rabbit anti-Human CD105 Antibody (WB) LS-C782782

Artikelnummer: LS-C782782-100
Artikelname: Polyclonal Rabbit anti-Human CD105 Antibody (WB) LS-C782782
Artikelnummer: LS-C782782-100
Hersteller Artikelnummer: LS-C782782-100
Alternativnummer: LS-C782782-100
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Amino acids 258-297 (YVSWLIDANHNMQIWTTGEYSFKIFPEKNIRGFKLPDTPQ) from the human protein were used as the immunogen for the Endoglin antibody.
Konjugation: Unconjugated
Alternative Synonym: ENG, CD105, CD105 antigen, END, HHT1, ORW, ORW1, Osler-Rendu-Weber syndrome 1, Endoglin
CD105 antibody LS-C782782 is an unconjugated rabbit polyclonal antibody to CD105 from human. It is reactive with human, mouse and rat. Validated for WB.
Klonalität: Polyclonal
NCBI: 2022
Puffer: Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Reinheit: Antigen Affinity purification
Formulierung: Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Application Verdünnung: WB (0.5 - 1 µg/ml)
Anwendungsbeschreibung: Optimal dilution of the Endoglin antibody should be determined by the researcher.