Polyclonal Rabbit anti-Human CD105 Antibody (WB) LS-C782782

Catalog Number: LS-C782782-100
Article Name: Polyclonal Rabbit anti-Human CD105 Antibody (WB) LS-C782782
Biozol Catalog Number: LS-C782782-100
Supplier Catalog Number: LS-C782782-100
Alternative Catalog Number: LS-C782782-100
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Amino acids 258-297 (YVSWLIDANHNMQIWTTGEYSFKIFPEKNIRGFKLPDTPQ) from the human protein were used as the immunogen for the Endoglin antibody.
Conjugation: Unconjugated
Alternative Names: ENG, CD105, CD105 antigen, END, HHT1, ORW, ORW1, Osler-Rendu-Weber syndrome 1, Endoglin
CD105 antibody LS-C782782 is an unconjugated rabbit polyclonal antibody to CD105 from human. It is reactive with human, mouse and rat. Validated for WB.
Clonality: Polyclonal
NCBI: 2022
Buffer: Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Purity: Antigen Affinity purification
Form: Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Application Dilute: WB (0.5 - 1 µg/ml)
Application Notes: Optimal dilution of the Endoglin antibody should be determined by the researcher.