Polyclonal Rabbit anti-Human CHRNA5 Antibody (IHC, WB) LS-C782791

Artikelnummer: LS-C782791-100
Artikelname: Polyclonal Rabbit anti-Human CHRNA5 Antibody (IHC, WB) LS-C782791
Artikelnummer: LS-C782791-100
Hersteller Artikelnummer: LS-C782791-100
Alternativnummer: LS-C782791-100
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Amino acids 44-76 (AKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKF) from the human protein were used as the immunogen for the CHRNA5 antibody.
Konjugation: Unconjugated
Alternative Synonym: CHRNA5, Acra-5, AChR-alpha5, LNCR2, NAChR alpha 5, NACHRA5
CHRNA5 antibody LS-C782791 is an unconjugated rabbit polyclonal antibody to CHRNA5 from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Klonalität: Polyclonal
NCBI: 1138
Puffer: Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Reinheit: Antigen Affinity purification
Formulierung: Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Application Verdünnung: IHC-P (1 - 2 µg/ml), WB (0.5 - 1 µg/ml)
Anwendungsbeschreibung: Optimal dilution of the CHRNA5 antibody should be determined by the researcher.