Polyclonal Rabbit anti-Human CHRNA5 Antibody (IHC, WB) LS-C782791

Catalog Number: LS-C782791-100
Article Name: Polyclonal Rabbit anti-Human CHRNA5 Antibody (IHC, WB) LS-C782791
Biozol Catalog Number: LS-C782791-100
Supplier Catalog Number: LS-C782791-100
Alternative Catalog Number: LS-C782791-100
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Amino acids 44-76 (AKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKF) from the human protein were used as the immunogen for the CHRNA5 antibody.
Conjugation: Unconjugated
Alternative Names: CHRNA5, Acra-5, AChR-alpha5, LNCR2, NAChR alpha 5, NACHRA5
CHRNA5 antibody LS-C782791 is an unconjugated rabbit polyclonal antibody to CHRNA5 from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Clonality: Polyclonal
NCBI: 1138
Buffer: Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Purity: Antigen Affinity purification
Form: Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Application Dilute: IHC-P (1 - 2 µg/ml), WB (0.5 - 1 µg/ml)
Application Notes: Optimal dilution of the CHRNA5 antibody should be determined by the researcher.