Polyclonal Rabbit anti-Human NOS2 / iNOS Antibody (WB) LS-C782794
Artikelnummer:
LS-C782794-100
| Artikelname: |
Polyclonal Rabbit anti-Human NOS2 / iNOS Antibody (WB) LS-C782794 |
| Artikelnummer: |
LS-C782794-100 |
| Hersteller Artikelnummer: |
LS-C782794-100 |
| Alternativnummer: |
LS-C782794-100 |
| Hersteller: |
LifeSpan Biosciences |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
Amino acids 1088-1126 (ARDVAHTLKQLVAAKLKLNEEQVEDYFFQLKSQKRYHED) from the human protein were used as the immunogen for the iNOS antibody. |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
NOS2, Hepatocyte NOS, HEP-NOS, Inducible NOS, NOS, type II, NOS type II, Inducible NO synthase, NOS2A, INOS, NOS |
| INOS antibody LS-C782794 is an unconjugated rabbit polyclonal antibody to human iNOS (NOS2). Validated for WB. |
| Klonalität: |
Polyclonal |
| NCBI: |
4843 |
| Puffer: |
Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide. |
| Reinheit: |
Antigen Affinity purification |
| Formulierung: |
Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide. |
| Application Verdünnung: |
WB (0.5 - 1 µg/ml) |
| Anwendungsbeschreibung: |
Optimal dilution of the iNOS antibody should be determined by the researcher. |
