Polyclonal Rabbit anti-Human NOS2 / iNOS Antibody (WB) LS-C782794
Catalog Number:
LS-C782794-100
| Article Name: |
Polyclonal Rabbit anti-Human NOS2 / iNOS Antibody (WB) LS-C782794 |
| Biozol Catalog Number: |
LS-C782794-100 |
| Supplier Catalog Number: |
LS-C782794-100 |
| Alternative Catalog Number: |
LS-C782794-100 |
| Manufacturer: |
LifeSpan Biosciences |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
Amino acids 1088-1126 (ARDVAHTLKQLVAAKLKLNEEQVEDYFFQLKSQKRYHED) from the human protein were used as the immunogen for the iNOS antibody. |
| Conjugation: |
Unconjugated |
| Alternative Names: |
NOS2, Hepatocyte NOS, HEP-NOS, Inducible NOS, NOS, type II, NOS type II, Inducible NO synthase, NOS2A, INOS, NOS |
| INOS antibody LS-C782794 is an unconjugated rabbit polyclonal antibody to human iNOS (NOS2). Validated for WB. |
| Clonality: |
Polyclonal |
| NCBI: |
4843 |
| Buffer: |
Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide. |
| Purity: |
Antigen Affinity purification |
| Form: |
Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide. |
| Application Dilute: |
WB (0.5 - 1 µg/ml) |
| Application Notes: |
Optimal dilution of the iNOS antibody should be determined by the researcher. |
