Polyclonal Rabbit anti-Human GJC1 / CX45 / Connexin 45 Antibody (IHC, WB) LS-C782796

Produktübersicht

• Artikelname: Polyclonal Rabbit anti-Human GJC1 / CX45 / Connexin 45 Antibody (IHC, WB) LS-C782796
• Artikelnummer: LS-C782796-100
• Hersteller Artikelnummer: LS-C782796-100
• Alternativnummer: LS-C782796-100
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC-P, WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: Amino acids 91-131 (YLGYAIHKIAKMEHGEADKKAARSKPYAMRWKQHRALEETE) from the human protein were used as the immunogen for the GJC1 antibody.
• Konjugation: Unconjugated
• Alternative Synonym: GJC1, Connexin-45, Connexin 45, Gap junction alpha-7 protein, Gap junction gamma-1 protein, CX45, Gap junction protein alpha-6, GJA7

Produktbeschreibung

Connexin 45 antibody LS-C782796 is an unconjugated rabbit polyclonal antibody to Connexin 45 (GJC1 / CX45) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.

Produkteigenschaften

• Klonalität: Polyclonal
• NCBI: 10052
• Puffer: Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
• Reinheit: Antigen Affinity purification
• Formulierung: Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.

Anwendungsbeschreibung

• Application Verdünnung: IHC-P (1 - 2 µg/ml), WB (0.5 - 1 µg/ml)
• Anwendungsbeschreibung: Optimal dilution of the GJC1 antibody should be determined by the researcher.