Amino acids 91-131 (YLGYAIHKIAKMEHGEADKKAARSKPYAMRWKQHRALEETE) from the human protein were used as the immunogen for the GJC1 antibody.
Konjugation:
Unconjugated
Alternative Synonym:
GJC1, Connexin-45, Connexin 45, Gap junction alpha-7 protein, Gap junction gamma-1 protein, CX45, Gap junction protein alpha-6, GJA7
Connexin 45 antibody LS-C782796 is an unconjugated rabbit polyclonal antibody to Connexin 45 (GJC1 / CX45) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.