Polyclonal Rabbit anti-Human GJC1 / CX45 / Connexin 45 Antibody (IHC, WB) LS-C782796

Product Overview

• Article Name: Polyclonal Rabbit anti-Human GJC1 / CX45 / Connexin 45 Antibody (IHC, WB) LS-C782796
• Biozol Catalog Number: LS-C782796-100
• Supplier Catalog Number: LS-C782796-100
• Alternative Catalog Number: LS-C782796-100
• Manufacturer: LifeSpan Biosciences
• Host: Rabbit
• Category: Antikörper
• Application: IHC-P, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: Amino acids 91-131 (YLGYAIHKIAKMEHGEADKKAARSKPYAMRWKQHRALEETE) from the human protein were used as the immunogen for the GJC1 antibody.
• Conjugation: Unconjugated
• Alternative Names: GJC1, Connexin-45, Connexin 45, Gap junction alpha-7 protein, Gap junction gamma-1 protein, CX45, Gap junction protein alpha-6, GJA7

Product Description

Connexin 45 antibody LS-C782796 is an unconjugated rabbit polyclonal antibody to Connexin 45 (GJC1 / CX45) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.

Product Properties

• Clonality: Polyclonal
• NCBI: 10052
• Buffer: Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
• Purity: Antigen Affinity purification
• Form: Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.

Application Notes

• Application Dilute: IHC-P (1 - 2 µg/ml), WB (0.5 - 1 µg/ml)
• Application Notes: Optimal dilution of the GJC1 antibody should be determined by the researcher.