SARS-CoV-2 ORF7a Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
MBL-CNA20307T
Artikelname: |
SARS-CoV-2 ORF7a Rabbit pAb, Unconjugated, Polyclonal |
Artikelnummer: |
MBL-CNA20307T |
Hersteller Artikelnummer: |
CNA20307T |
Alternativnummer: |
MBL-CNA20307T |
Hersteller: |
MBL |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Spezies Reaktivität: |
Virus |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 16-98 of coronavirus ORF7a (YP_009724395.1). |
Konjugation: |
Unconjugated |
Alternative Synonym: |
sars-cov-2 |
Klonalität: |
Polyclonal |
Molekulargewicht: |
14kDa |
Quelle: |
Rabbit |
Reinheit: |
Affinity purification |
Formulierung: |
PBS with 0.01% thimerosal,50% glycerol |
Sequenz: |
ELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYS |
Target-Kategorie: |
Recombinant fusion protein containing a sequence corresponding to amino acids 16-98 of coronavirus ORF7a (YP_009724395.1). |
Application Verdünnung: |
WB,1:500 - 1:1000 |