SARS-CoV-2 ORF7a Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA20307T
Article Name: |
SARS-CoV-2 ORF7a Rabbit pAb, Unconjugated, Polyclonal |
Biozol Catalog Number: |
MBL-CNA20307T |
Supplier Catalog Number: |
CNA20307T |
Alternative Catalog Number: |
MBL-CNA20307T |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Virus |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 16-98 of coronavirus ORF7a (YP_009724395.1). |
Conjugation: |
Unconjugated |
Alternative Names: |
sars-cov-2 |
Clonality: |
Polyclonal |
Molecular Weight: |
14kDa |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.01% thimerosal,50% glycerol |
Sequence: |
ELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYS |
Target: |
Recombinant fusion protein containing a sequence corresponding to amino acids 16-98 of coronavirus ORF7a (YP_009724395.1). |
Application Dilute: |
WB,1:500 - 1:1000 |