SARS-CoV-2 Spike S1 Rabbit mAb, Clone: [ARC51489], Unconjugated, Monoclonal
Artikelnummer:
MBL-CNA20834P
Artikelname: |
SARS-CoV-2 Spike S1 Rabbit mAb, Clone: [ARC51489], Unconjugated, Monoclonal |
Artikelnummer: |
MBL-CNA20834P |
Hersteller Artikelnummer: |
CNA20834P |
Alternativnummer: |
MBL-CNA20834P |
Hersteller: |
MBL |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
IF, WB |
Spezies Reaktivität: |
Virus |
Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 200-300 of SARS-CoV-2 Spike S1 (YP_009724390.1). |
Konjugation: |
Unconjugated |
Alternative Synonym: |
sars-cov-2 |
Klonalität: |
Monoclonal |
Klon-Bezeichnung: |
[ARC51489] |
Molekulargewicht: |
141kDa |
Quelle: |
Rabbit |
Reinheit: |
Affinity purification |
Formulierung: |
PBS with 0.05% proclin300,0.05% BSA,50% glycerol |
Sequenz: |
YFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETK |
Target-Kategorie: |
A synthetic peptide corresponding to a sequence within amino acids 200-300 of SARS-CoV-2 Spike S1 (YP_009724390.1). |
Application Verdünnung: |
WB,1:2000 - 1:10000|IF/ICC,1:50 - 1:200 |