SARS-CoV-2 Spike S1 Rabbit mAb, Clone: [ARC51489], Unconjugated, Monoclonal
Artikelnummer:
MBL-CNA20834P
| Artikelname: |
SARS-CoV-2 Spike S1 Rabbit mAb, Clone: [ARC51489], Unconjugated, Monoclonal |
| Artikelnummer: |
MBL-CNA20834P |
| Hersteller Artikelnummer: |
CNA20834P |
| Alternativnummer: |
MBL-CNA20834P |
| Hersteller: |
MBL |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IF, WB |
| Spezies Reaktivität: |
Virus |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 200-300 of SARS-CoV-2 Spike S1 (YP_009724390.1). |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
sars-cov-2 |
| Klonalität: |
Monoclonal |
| Klon-Bezeichnung: |
[ARC51489] |
| Molekulargewicht: |
141kDa |
| Quelle: |
Rabbit |
| Reinheit: |
Affinity purification |
| Formulierung: |
PBS with 0.05% proclin300,0.05% BSA,50% glycerol |
| Sequenz: |
YFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETK |
| Target-Kategorie: |
A synthetic peptide corresponding to a sequence within amino acids 200-300 of SARS-CoV-2 Spike S1 (YP_009724390.1). |
| Application Verdünnung: |
WB,1:2000 - 1:10000|IF/ICC,1:50 - 1:200 |
