SARS-CoV-2 Spike S1 Rabbit mAb, Clone: [ARC51489], Unconjugated, Monoclonal
Catalog Number:
MBL-CNA20834P
| Article Name: |
SARS-CoV-2 Spike S1 Rabbit mAb, Clone: [ARC51489], Unconjugated, Monoclonal |
| Biozol Catalog Number: |
MBL-CNA20834P |
| Supplier Catalog Number: |
CNA20834P |
| Alternative Catalog Number: |
MBL-CNA20834P |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IF, WB |
| Species Reactivity: |
Virus |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 200-300 of SARS-CoV-2 Spike S1 (YP_009724390.1). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
sars-cov-2 |
| Clonality: |
Monoclonal |
| Clone Designation: |
[ARC51489] |
| Molecular Weight: |
141kDa |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.05% proclin300,0.05% BSA,50% glycerol |
| Sequence: |
YFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETK |
| Target: |
A synthetic peptide corresponding to a sequence within amino acids 200-300 of SARS-CoV-2 Spike S1 (YP_009724390.1). |
| Application Dilute: |
WB,1:2000 - 1:10000|IF/ICC,1:50 - 1:200 |
