SARS-CoV-2 Spike S1 Rabbit mAb, Clone: [ARC51489], Unconjugated, Monoclonal
Catalog Number:
MBL-CNA20834P
Article Name: |
SARS-CoV-2 Spike S1 Rabbit mAb, Clone: [ARC51489], Unconjugated, Monoclonal |
Biozol Catalog Number: |
MBL-CNA20834P |
Supplier Catalog Number: |
CNA20834P |
Alternative Catalog Number: |
MBL-CNA20834P |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
IF, WB |
Species Reactivity: |
Virus |
Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 200-300 of SARS-CoV-2 Spike S1 (YP_009724390.1). |
Conjugation: |
Unconjugated |
Alternative Names: |
sars-cov-2 |
Clonality: |
Monoclonal |
Clone Designation: |
[ARC51489] |
Molecular Weight: |
141kDa |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.05% proclin300,0.05% BSA,50% glycerol |
Sequence: |
YFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETK |
Target: |
A synthetic peptide corresponding to a sequence within amino acids 200-300 of SARS-CoV-2 Spike S1 (YP_009724390.1). |
Application Dilute: |
WB,1:2000 - 1:10000|IF/ICC,1:50 - 1:200 |