PMAP-36, CAS [[154338-08-6]] Preis auf Anfrage

Artikelnummer: MCE-HY-P10158
Artikelname: PMAP-36, CAS [[154338-08-6]] Preis auf Anfrage
Artikelnummer: MCE-HY-P10158
Hersteller Artikelnummer: HY-P10158
Alternativnummer: MCE-HY-P10158-1UNIT
Hersteller: MedchemExpress
Kategorie: Proteine/Peptide
Alternative Synonym: Porcine cathelicidin PMAP-36
PMAP-36 is an antimicrobial peptide, with sequence of GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG. PMAP-36 with traditional antibiotics can enhance[1].
Molekulargewicht: 4157.17
CAS Nummer: [154338-08-6]
Formel: C191H336N62O39S
Target-Kategorie: Bacterial
Anwendungsbeschreibung: MCE Product type: Peptides