PMAP-36, CAS [[154338-08-6]] Preis auf Anfrage
Catalog Number:
MCE-HY-P10158
| Article Name: |
PMAP-36, CAS [[154338-08-6]] Preis auf Anfrage |
| Biozol Catalog Number: |
MCE-HY-P10158 |
| Supplier Catalog Number: |
HY-P10158 |
| Alternative Catalog Number: |
MCE-HY-P10158-1UNIT |
| Manufacturer: |
MedchemExpress |
| Category: |
Proteine/Peptide |
| Alternative Names: |
Porcine cathelicidin PMAP-36 |
| PMAP-36 is an antimicrobial peptide, with sequence of GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG. PMAP-36 with traditional antibiotics can enhance[1]. |
| Molecular Weight: |
4157.17 |
| CAS Number: |
[154338-08-6] |
| Formula: |
C191H336N62O39S |
| Target: |
Bacterial |
| Application Notes: |
Peptides |
