HKDC1 Antibody, Rabbit, Polyclonal

Produktübersicht

• Artikelname: HKDC1 Antibody, Rabbit, Polyclonal
• Artikelnummer: NSJ-R32256
• Hersteller Artikelnummer: R32256
• Alternativnummer: NSJ-R32256
• Hersteller: NSJ Bioreagents
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: Amino acids KRHVQMESQFYPTPNEIIRGNGTELFEYVADCLAD of human HKDC1 were used as the immunogen for the HKDC1 antibody.

Produktbeschreibung

HKDC1 (hexokinase domain containing 1) is a protein that belongs to the hexokinase family and functions to catalyze the ATP-dependent conversion of D-hexose to D-hexose 6-phosphate.

Produkteigenschaften

• Klonalität: Polyclonal
• UniProt: Q2TB90
• Puffer: Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
• Reinheit: Antigen affinity
• Formulierung: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: Western blot: 0.1-0.5ug/ml
• Anwendungsbeschreibung: Optimal dilution of the HKDC1 antibody should be determined by the researcher.