HKDC1 Antibody, Rabbit, Polyclonal

Product Overview

• Article Name: HKDC1 Antibody, Rabbit, Polyclonal
• Biozol Catalog Number: NSJ-R32256
• Supplier Catalog Number: R32256
• Alternative Catalog Number: NSJ-R32256
• Manufacturer: NSJ Bioreagents
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: Amino acids KRHVQMESQFYPTPNEIIRGNGTELFEYVADCLAD of human HKDC1 were used as the immunogen for the HKDC1 antibody.

Product Description

HKDC1 (hexokinase domain containing 1) is a protein that belongs to the hexokinase family and functions to catalyze the ATP-dependent conversion of D-hexose to D-hexose 6-phosphate.

Product Properties

• Clonality: Polyclonal
• UniProt: Q2TB90
• Buffer: Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
• Purity: Antigen affinity
• Form: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: Western blot: 0.1-0.5ug/ml
• Application Notes: Optimal dilution of the HKDC1 antibody should be determined by the researcher.