Sp5 Antibody, Rabbit, Polyclonal

Produktübersicht

• Artikelname: Sp5 Antibody, Rabbit, Polyclonal
• Artikelnummer: NSJ-R32265
• Hersteller Artikelnummer: R32265
• Alternativnummer: NSJ-R32265
• Hersteller: NSJ Bioreagents
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Amino acids DFAQYQSQIAALLQTKAPLAATARRCRRCR of human Sp5 were used as the immunogen for the Sp5 antibody.

Produktbeschreibung

Sp5 is mapped to 2q31.1. It is a member of the Sp family of zinc finger transcription factors. Like other family members, the Sp5 protein contains a Cys2His2 zinc finger DNA binding domain at the C-terminus. Elevated expression of Sp5 has been noted in several human tumors including hepatocellular carcinoma, gastric cancer and colon cancer.

Produkteigenschaften

• Klonalität: Polyclonal
• UniProt: Q6BEB4
• Puffer: Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
• Reinheit: Antigen affinity
• Formulierung: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml
• Anwendungsbeschreibung: Optimal dilution of the Sp5 antibody should be determined by the researcher.