Sp5 Antibody, Rabbit, Polyclonal

Product Overview

• Article Name: Sp5 Antibody, Rabbit, Polyclonal
• Biozol Catalog Number: NSJ-R32265
• Supplier Catalog Number: R32265
• Alternative Catalog Number: NSJ-R32265
• Manufacturer: NSJ Bioreagents
• Host: Rabbit
• Category: Antikörper
• Application: IHC-P, WB
• Species Reactivity: Human
• Immunogen: Amino acids DFAQYQSQIAALLQTKAPLAATARRCRRCR of human Sp5 were used as the immunogen for the Sp5 antibody.

Product Description

Sp5 is mapped to 2q31.1. It is a member of the Sp family of zinc finger transcription factors. Like other family members, the Sp5 protein contains a Cys2His2 zinc finger DNA binding domain at the C-terminus. Elevated expression of Sp5 has been noted in several human tumors including hepatocellular carcinoma, gastric cancer and colon cancer.

Product Properties

• Clonality: Polyclonal
• UniProt: Q6BEB4
• Buffer: Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
• Purity: Antigen affinity
• Form: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml
• Application Notes: Optimal dilution of the Sp5 antibody should be determined by the researcher.