HTRA1 Antibody, Rabbit, Polyclonal

Produktübersicht

• Artikelname: HTRA1 Antibody, Rabbit, Polyclonal
• Artikelnummer: NSJ-RQ4205
• Hersteller Artikelnummer: RQ4205
• Alternativnummer: NSJ-RQ4205
• Hersteller: NSJ Bioreagents
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC-P, WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: Amino acids QLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIAD were used as the immunogen for the HTRA1 antibody.

Produktbeschreibung

Serine protease HTRA1 is an enzyme that in humans is encoded by the HTRA1 gene. This gene encodes a member of the trypsin family of serine proteases. This protein is a secreted enzyme that is proposed to regulate the availability of insulin-like growth f

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Isotyp: Rabbit IgG
• UniProt: Q92743
• Puffer: Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
• Reinheit: Antigen affinity purified
• Formulierung: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Formel: Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
• Target-Kategorie: HTRA1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: Western Blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml
• Anwendungsbeschreibung: Optimal dilution of the HTRA1 antibody should be determined by the researcher.

Bilder