HTRA1 Antibody, Rabbit, Polyclonal

Product Overview

• Article Name: HTRA1 Antibody, Rabbit, Polyclonal
• Biozol Catalog Number: NSJ-RQ4205
• Supplier Catalog Number: RQ4205
• Alternative Catalog Number: NSJ-RQ4205
• Manufacturer: NSJ Bioreagents
• Host: Rabbit
• Category: Antikörper
• Application: IHC-P, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: Amino acids QLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIAD were used as the immunogen for the HTRA1 antibody.

Product Description

Serine protease HTRA1 is an enzyme that in humans is encoded by the HTRA1 gene. This gene encodes a member of the trypsin family of serine proteases. This protein is a secreted enzyme that is proposed to regulate the availability of insulin-like growth f

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Isotype: Rabbit IgG
• UniProt: Q92743
• Buffer: Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
• Purity: Antigen affinity purified
• Form: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Formula: Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
• Target: HTRA1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: Western Blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml
• Application Notes: Optimal dilution of the HTRA1 antibody should be determined by the researcher.

Images