GFI1 Antibody, Rabbit, Polyclonal

Produktübersicht

• Artikelname: GFI1 Antibody, Rabbit, Polyclonal
• Artikelnummer: NSJ-RQ4261
• Hersteller Artikelnummer: RQ4261
• Alternativnummer: NSJ-RQ4261
• Hersteller: NSJ Bioreagents
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC-P
• Spezies Reaktivität: Human
• Immunogen: Amino acids NLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQH were used as the immunogen for the GFI1 antibody.

Produktbeschreibung

Zinc finger protein Gfi-1 is a protein that in humans is encoded by the GFI1 gene. This gene encodes a nuclear zinc finger protein that functions as a transcriptional repressor. This protein plays a role in diverse developmental contexts, including hemat

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Isotyp: Rabbit IgG
• UniProt: Q99684
• Puffer: Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
• Reinheit: Antigen affinity purified
• Formulierung: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Formel: Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
• Target-Kategorie: GFI1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: Immunohistochemistry (FFPE): 1-2ug/ml
• Anwendungsbeschreibung: Optimal dilution of the GFI1 antibody should be determined by the researcher.

Bilder

IHC testing of FFPE human rectal cancer tissue with GFI1 antibody at 1ug/ml. R