GFI1 Antibody, Rabbit, Polyclonal

Product Overview

• Article Name: GFI1 Antibody, Rabbit, Polyclonal
• Biozol Catalog Number: NSJ-RQ4261
• Supplier Catalog Number: RQ4261
• Alternative Catalog Number: NSJ-RQ4261
• Manufacturer: NSJ Bioreagents
• Host: Rabbit
• Category: Antikörper
• Application: IHC-P
• Species Reactivity: Human
• Immunogen: Amino acids NLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQH were used as the immunogen for the GFI1 antibody.

Product Description

Zinc finger protein Gfi-1 is a protein that in humans is encoded by the GFI1 gene. This gene encodes a nuclear zinc finger protein that functions as a transcriptional repressor. This protein plays a role in diverse developmental contexts, including hemat

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Isotype: Rabbit IgG
• UniProt: Q99684
• Buffer: Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
• Purity: Antigen affinity purified
• Form: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Formula: Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
• Target: GFI1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: Immunohistochemistry (FFPE): 1-2ug/ml
• Application Notes: Optimal dilution of the GFI1 antibody should be determined by the researcher.

Images

IHC testing of FFPE human rectal cancer tissue with GFI1 antibody at 1ug/ml. R