SARS-CoV-2 RNA polymerase Antibody / NSP12, Rabbit, Polyclonal

Artikelnummer: NSJ-RQ6306
Artikelname: SARS-CoV-2 RNA polymerase Antibody / NSP12, Rabbit, Polyclonal
Artikelnummer: NSJ-RQ6306
Hersteller Artikelnummer: RQ6306
Alternativnummer: NSJ-RQ6306
Hersteller: NSJ Bioreagents
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA
Spezies Reaktivität: Human
Immunogen: Amino acids SADAQSFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNDKVAGFAKFLKTNCCRFQEKDEDDNLIDSYFVVKRHTFSNYQHEETIYNLLKDCPAVAKHDFFKFRIDGDMVP
HISRQRLTKYTMADLVYALRHFDEGNCDTLKEILVTYNCCDDDYFNKggggDPSRILGAGCFVDDIVKTDGTLMIERFVSLAIDAYPLTKHPNQEYADVFHLYLQYIRKLHDELT
GHMLDMYSVMLTNDNTSRYWEPEFYEAMYTPHTVLQ were used as the immunogen for the SARS-CoV-2 RNA polymerase antibody.
Alternative Synonym: sars-cov-2
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that direct virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ ORF1ab, the largest gene, contains overlapping open reading frames that encode polyproteins PP1ab and PP1a. The polyproteins are cleaved to yield 16 nonstructural proteins, NSP1-16. Production of the longer (PP1ab) or shorter protein (PP1a) depends on a -1 ribosomal frameshifting event. The proteins, based on similarity to other coronaviruses, include the papain-like proteinase protein (NSP3), 3C-like proteinase (NSP5), RNA-dependent RNA polymerase (NSP12, RdRp), helicase (NSP13, HEL), endoRNAse (NSP15), 2-O-Ribose-Methyltransferase (NSP16) and other nonstructural proteins. SARS-CoV-2 nonstructural proteins are responsible for viral transcription, replication, proteolytic processing, suppression of host immune responses and suppression of host gene expression. The RNA-dependent RNA polymerase is a target of antiviral therapies.
Klonalität: Polyclonal
UniProt: P0DTD1
Puffer: Lyophilized from 1X PBS with 2% Trehalose
Reinheit: Affinity purified
Formulierung: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Antibody Type: Primary Antibody
Application Verdünnung: ELISA
Anwendungsbeschreibung: Optimal dilution of the SARS-CoV-2 RNA polymerase antibody should be determined by the researcher.