SARS-CoV-2 RNA polymerase Antibody / NSP12, Rabbit, Polyclonal

Catalog Number: NSJ-RQ6306
Article Name: SARS-CoV-2 RNA polymerase Antibody / NSP12, Rabbit, Polyclonal
Biozol Catalog Number: NSJ-RQ6306
Supplier Catalog Number: RQ6306
Alternative Catalog Number: NSJ-RQ6306
Manufacturer: NSJ Bioreagents
Host: Rabbit
Category: Antikörper
Application: ELISA
Species Reactivity: Human
Immunogen: Amino acids SADAQSFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNDKVAGFAKFLKTNCCRFQEKDEDDNLIDSYFVVKRHTFSNYQHEETIYNLLKDCPAVAKHDFFKFRIDGDMVP
HISRQRLTKYTMADLVYALRHFDEGNCDTLKEILVTYNCCDDDYFNKggggDPSRILGAGCFVDDIVKTDGTLMIERFVSLAIDAYPLTKHPNQEYADVFHLYLQYIRKLHDELT
GHMLDMYSVMLTNDNTSRYWEPEFYEAMYTPHTVLQ were used as the immunogen for the SARS-CoV-2 RNA polymerase antibody.
Alternative Names: sars-cov-2
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that direct virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ ORF1ab, the largest gene, contains overlapping open reading frames that encode polyproteins PP1ab and PP1a. The polyproteins are cleaved to yield 16 nonstructural proteins, NSP1-16. Production of the longer (PP1ab) or shorter protein (PP1a) depends on a -1 ribosomal frameshifting event. The proteins, based on similarity to other coronaviruses, include the papain-like proteinase protein (NSP3), 3C-like proteinase (NSP5), RNA-dependent RNA polymerase (NSP12, RdRp), helicase (NSP13, HEL), endoRNAse (NSP15), 2-O-Ribose-Methyltransferase (NSP16) and other nonstructural proteins. SARS-CoV-2 nonstructural proteins are responsible for viral transcription, replication, proteolytic processing, suppression of host immune responses and suppression of host gene expression. The RNA-dependent RNA polymerase is a target of antiviral therapies.
Clonality: Polyclonal
UniProt: P0DTD1
Buffer: Lyophilized from 1X PBS with 2% Trehalose
Purity: Affinity purified
Form: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Antibody Type: Primary Antibody
Application Dilute: ELISA
Application Notes: Optimal dilution of the SARS-CoV-2 RNA polymerase antibody should be determined by the researcher.