ACTH (1-39), human

Artikelnummer: PEL-EP10644_1
Artikelname: ACTH (1-39), human
Artikelnummer: PEL-EP10644_1
Hersteller Artikelnummer: EP10644_1
Alternativnummer: PEL-EP10644_1
Hersteller: peptides and elephants
Kategorie: Proteine/Peptide
Applikation: ELISpot, FACS, FC, FluoroSpot, IHC, WB
Spezies Reaktivität: Human
ACTH (1-39), human is a synthetic peptide corresponding to the first 39 amino acids of human ACTH/adrenocorticotropin which is the major regulator of adrenal cortex function. ACTH stimulates the synthesis of steroidal hormones.
Reinheit: 95%
Sequenz: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF