ACTH (1-39), human

Catalog Number: PEL-EP10644_1
Article Name: ACTH (1-39), human
Biozol Catalog Number: PEL-EP10644_1
Supplier Catalog Number: EP10644_1
Alternative Catalog Number: PEL-EP10644_1
Manufacturer: peptides and elephants
Category: Proteine/Peptide
Application: ELISpot, FACS, FC, FluoroSpot, IHC, WB
Species Reactivity: Human
ACTH (1-39), human is a synthetic peptide corresponding to the first 39 amino acids of human ACTH/adrenocorticotropin which is the major regulator of adrenal cortex function. ACTH stimulates the synthesis of steroidal hormones.
Purity: 95%
Sequence: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF