Human pro-BNP (1-108) Recombinant

Artikelnummer: RAY-227-10136
Artikelname: Human pro-BNP (1-108) Recombinant
Artikelnummer: RAY-227-10136
Hersteller Artikelnummer: 227-10136
Alternativnummer: RAY-227-10136
Hersteller: RayBiotech
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
pro-Brain Natriuretic Peptide (proBNP) (a.a. 1-108) Recombinant
Konzentration: 10 ug/mL (OD280nm, E0.1% = 0.59) (prior to lyophilization).
Molekulargewicht: 12,183 Da. Sequence: GRAPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVA TEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRHM (underlined amino acids were added during production and differ from the original sequence).
Expression System: E. coli
Reinheit: > 95% pure (SDS-PAGE).
Formulierung: Purified, Lyophilized
Formel: Lyophilized from 200 mM Ammonium Acetate, pH 7.0. Reconstitute in 10 uL of double distilled buffer.
Application Verdünnung: Specific methodologies have not been tested using this product.