10 ug/mL (OD280nm, E0.1% = 0.59) (prior to lyophilization).
Molecular Weight:
12,183 Da. Sequence: GRAPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVA TEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRHM (underlined amino acids were added during production and differ from the original sequence).
Expression System:
E. coli
Purity:
> 95% pure (SDS-PAGE).
Form:
Purified, Lyophilized
Formula:
Lyophilized from 200 mM Ammonium Acetate, pH 7.0. Reconstitute in 10 uL of double distilled buffer.
Application Dilute:
Specific methodologies have not been tested using this product.
* VAT and and shipping costs not included. Errors and price changes excepted
