Eotaxin-2, Human Recombinant (CCL24)
Artikelnummer:
RAY-228-10398-2
- Bilder (0)
| Artikelname: | Eotaxin-2, Human Recombinant (CCL24) |
| Artikelnummer: | RAY-228-10398-2 |
| Hersteller Artikelnummer: | 228-10398-2 |
| Alternativnummer: | RAY-228-10398-2 |
| Hersteller: | RayBiotech |
| Kategorie: | Proteine/Peptide |
| Spezies Reaktivität: | Human |
| Alternative Synonym: | C-C motif chemokine 24, Small-inducible cytokine A24, Myeloid progenitor inhibitory factor 2, CK-beta-6, Eosinophil chemotactic protein 2, Eotaxin-2, CCL24, Ckb-6, MPIF2, MPIF-2, SCYA24, Eotaxin2, CCL-24. |
| NCBI: | 6369 |
| Expression System: | E. coli |
| Reinheit: | Greater than 97.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Formulierung: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Sequenz: | VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIFTTKKGQQFCGDPKQEWV QRYMKNLDAKQKKASPRARAVA. |
| Formel: | The CCL24 protein was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM PBS pH-7.4 and 0.15M sodium chloride. |
Produktgarantie und fachkundiger Support
