Eotaxin-2, Human Recombinant (CCL24)
Catalog Number:
RAY-228-10398-2
| Article Name: |
Eotaxin-2, Human Recombinant (CCL24) |
| Biozol Catalog Number: |
RAY-228-10398-2 |
| Supplier Catalog Number: |
228-10398-2 |
| Alternative Catalog Number: |
RAY-228-10398-2 |
| Manufacturer: |
RayBiotech |
| Category: |
Proteine/Peptide |
| Species Reactivity: |
Human |
| Alternative Names: |
C-C motif chemokine 24, Small-inducible cytokine A24, Myeloid progenitor inhibitory factor 2, CK-beta-6, Eosinophil chemotactic protein 2, Eotaxin-2, CCL24, Ckb-6, MPIF2, MPIF-2, SCYA24, Eotaxin2, CCL-24. |
| NCBI: |
6369 |
| Expression System: |
E. coli |
| Purity: |
Greater than 97.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Form: |
Sterile Filtered White lyophilized (freeze-dried) powder. |
| Sequence: |
VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIFTTKKGQQFCGDPKQEWV QRYMKNLDAKQKKASPRARAVA. |
| Formula: |
The CCL24 protein was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM PBS pH-7.4 and 0.15M sodium chloride. |