Eotaxin-2, Human Recombinant (CCL24)

Catalog Number: RAY-228-10398-2
Article Name: Eotaxin-2, Human Recombinant (CCL24)
Biozol Catalog Number: RAY-228-10398-2
Supplier Catalog Number: 228-10398-2
Alternative Catalog Number: RAY-228-10398-2
Manufacturer: RayBiotech
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: C-C motif chemokine 24, Small-inducible cytokine A24, Myeloid progenitor inhibitory factor 2, CK-beta-6, Eosinophil chemotactic protein 2, Eotaxin-2, CCL24, Ckb-6, MPIF2, MPIF-2, SCYA24, Eotaxin2, CCL-24.
NCBI: 6369
Expression System: E. coli
Purity: Greater than 97.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIFTTKKGQQFCGDPKQEWV QRYMKNLDAKQKKASPRARAVA.
Formula: The CCL24 protein was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM PBS pH-7.4 and 0.15M sodium chloride.