Fibroblast Growth Factor-23, Human Recombinant, His Tag
Artikelnummer:
RAY-228-10462-3
| Artikelname: |
Fibroblast Growth Factor-23, Human Recombinant, His Tag |
| Artikelnummer: |
RAY-228-10462-3 |
| Hersteller Artikelnummer: |
228-10462-3 |
| Alternativnummer: |
RAY-228-10462-3 |
| Hersteller: |
RayBiotech |
| Kategorie: |
Proteine/Peptide |
| Spezies Reaktivität: |
Human |
| Alternative Synonym: |
Tumor-derived hypophosphatemia-inducing factor, HYPF, ADHR, HPDR2, PHPTC, FGF23, FGF-23, Fibroblast Growth Factor-23. |
| NCBI: |
8074 |
| Expression System: |
E. coli |
| Reinheit: |
Greater than 90.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Formulierung: |
Sterile Filtered white lyophilized powder. |
| Sequenz: |
MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFIHHHH |
| Formel: |
The protein (0.5mg/ml) was lyophilized from 25mM Tris pH7.5 and 0.6M NaCl solution. |