Fibroblast Growth Factor-23, Human Recombinant, His Tag
Catalog Number:
RAY-228-10462-3
| Article Name: |
Fibroblast Growth Factor-23, Human Recombinant, His Tag |
| Biozol Catalog Number: |
RAY-228-10462-3 |
| Supplier Catalog Number: |
228-10462-3 |
| Alternative Catalog Number: |
RAY-228-10462-3 |
| Manufacturer: |
RayBiotech |
| Category: |
Proteine/Peptide |
| Species Reactivity: |
Human |
| Alternative Names: |
Tumor-derived hypophosphatemia-inducing factor, HYPF, ADHR, HPDR2, PHPTC, FGF23, FGF-23, Fibroblast Growth Factor-23. |
| NCBI: |
8074 |
| Expression System: |
E. coli |
| Purity: |
Greater than 90.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Form: |
Sterile Filtered white lyophilized powder. |
| Sequence: |
MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFIHHHH |
| Formula: |
The protein (0.5mg/ml) was lyophilized from 25mM Tris pH7.5 and 0.6M NaCl solution. |