Fibroblast Growth Factor-23, Human Recombinant, His Tag

Catalog Number: RAY-228-10462-3
Article Name: Fibroblast Growth Factor-23, Human Recombinant, His Tag
Biozol Catalog Number: RAY-228-10462-3
Supplier Catalog Number: 228-10462-3
Alternative Catalog Number: RAY-228-10462-3
Manufacturer: RayBiotech
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: Tumor-derived hypophosphatemia-inducing factor, HYPF, ADHR, HPDR2, PHPTC, FGF23, FGF-23, Fibroblast Growth Factor-23.
NCBI: 8074
Expression System: E. coli
Purity: Greater than 90.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Form: Sterile Filtered white lyophilized powder.
Sequence: MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFIHHHH
Formula: The protein (0.5mg/ml) was lyophilized from 25mM Tris pH7.5 and 0.6M NaCl solution.