Human Vascular Endothelial Growth Inhibitor Recombinant
Artikelnummer:
RAY-228-11632-3
- Bilder (0)
| Artikelname: | Human Vascular Endothelial Growth Inhibitor Recombinant |
| Artikelnummer: | RAY-228-11632-3 |
| Hersteller Artikelnummer: | 228-11632-3 |
| Alternativnummer: | RAY-228-11632-3 |
| Hersteller: | RayBiotech |
| Kategorie: | Proteine/Peptide |
| Spezies Reaktivität: | Human |
| Alternative Synonym: | Tumor necrosis factor ligand superfamily member 15, TNFSF-15, TNFSF15, TNF ligand-related molecule 1, VEGI, TL-1, TL1, TL1A, VEGI192A, VEGI-192, MGC129934, MGC129935. |
| NCBI: | 9966 |
| Expression System: | E. coli |
| Reinheit: | Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Formulierung: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Sequenz: | MQLTKGRLHFSHPLSHTKHISPFVTDAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL. |
| Formel: | The TNFSF15 was lyophilized from a 0.2 um filtered concentrated solution in PBS, pH 7.4 with 0.02% Tween-20. |
Produktgarantie und fachkundiger Support
