Human Vascular Endothelial Growth Inhibitor Recombinant
Catalog Number:
RAY-228-11632-3
- Images (0)
| Article Name: | Human Vascular Endothelial Growth Inhibitor Recombinant |
| Biozol Catalog Number: | RAY-228-11632-3 |
| Supplier Catalog Number: | 228-11632-3 |
| Alternative Catalog Number: | RAY-228-11632-3 |
| Manufacturer: | RayBiotech |
| Category: | Proteine/Peptide |
| Species Reactivity: | Human |
| Alternative Names: | Tumor necrosis factor ligand superfamily member 15, TNFSF-15, TNFSF15, TNF ligand-related molecule 1, VEGI, TL-1, TL1, TL1A, VEGI192A, VEGI-192, MGC129934, MGC129935. |
| NCBI: | 9966 |
| Expression System: | E. coli |
| Purity: | Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Form: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Sequence: | MQLTKGRLHFSHPLSHTKHISPFVTDAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL. |
| Formula: | The TNFSF15 was lyophilized from a 0.2 um filtered concentrated solution in PBS, pH 7.4 with 0.02% Tween-20. |
Product Guarantee and Expert Support
