SARS-CoV-2 S1 (RBD) Delta B.1.617.2 (India), His-Tag

Produktübersicht

• Artikelname: SARS-CoV-2 S1 (RBD) Delta B.1.617.2 (India), His-Tag
• Artikelnummer: TRZ-P2020-060_1000
• Hersteller Artikelnummer: P2020-060_1000
• Alternativnummer: TRZ-P2020-060_1000
• Hersteller: trenzyme
• Kategorie: Biochemikalien
• Spezies Reaktivität: Virus
• Alternative Synonym: sars-cov-2

Produktbeschreibung

The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process. The target protein is also a major immunogen and a possible target for entry inhibitors. The SARS-CoV-2 spike (S) protein is a large type I transmembrane protein composed of two subunits, S1 and S2. The S1 subunit contains a receptor-binding domain (RBD) responsible for binding to the host cell receptor angiotensin-converting enzyme 2 (ACE2). Several mutants of the spike protein are known. A new SARS-CoV-2 lineage called B.1.617, exhibits 13 mutations. Compared to the previously circulating variants, the mutations L452R and T478K of the SARS-CoV-2 Spike S1 (RBD) may cause a stronger affinity of the spike protein to hACE2 and also conferring an increasing ability to evade the hosts’ immune system.

Produkteigenschaften

• Molekulargewicht: 27,6 kDa
• UniProt: P0DTC2
• Puffer: PBS
• Reinheit: > 75% as determined by SDS-PAGE
• Formulierung: liquid
• Sequenz: MRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTF KCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWN SNNLDSKVGGNYNYRYRLFRKSNLKPFERDISTEIYQAGSKPCNGVEGFNCYFPLQSYGF QPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
• Formel: pH 7,4

Bilder

Structural model of SARS-CoV-2 S1 (RBD) Delta B.1.617.2 (India) His-Tag

Histogram of SARS-CoV-2 S1 (RBD) Delta B.1.617.2 (India) His-Tag

SDS-Page of SARS-CoV-2 S1 (RBD) Delta B.1.617.2 (India) His-Tag