SARS-CoV-2 S1 (RBD) Delta B.1.617.2 (India), His-Tag

Product Overview

• Article Name: SARS-CoV-2 S1 (RBD) Delta B.1.617.2 (India), His-Tag
• Biozol Catalog Number: TRZ-P2020-060_1000
• Supplier Catalog Number: P2020-060_1000
• Alternative Catalog Number: TRZ-P2020-060_1000
• Manufacturer: trenzyme
• Category: Biochemikalien
• Species Reactivity: Virus
• Alternative Names: sars-cov-2

Product Description

The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process. The target protein is also a major immunogen and a possible target for entry inhibitors. The SARS-CoV-2 spike (S

Product Properties

• Molecular Weight: 27,6 kDa
• UniProt: P0DTC2
• Buffer: PBS
• Purity: > 75% as determined by SDS-PAGE
• Form: liquid
• Sequence: MRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTF KCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWN SNNLDSKVGGNYNYRYRLFRKSNLKPFERDISTEIYQAGSKPCNGVEGFNCYFPLQSYGF QPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
• Formula: pH 7,4

Images

Structural model of SARS-CoV-2 S1 (RBD) Delta B.1.617.2 (India) His-Tag

Histogram of SARS-CoV-2 S1 (RBD) Delta B.1.617.2 (India) His-Tag

SDS-Page of SARS-CoV-2 S1 (RBD) Delta B.1.617.2 (India) His-Tag