SARS-CoV-2 S1 (RBD) Delta B.1.617.2 (India), His-Tag

Product Overview

• Article Name: SARS-CoV-2 S1 (RBD) Delta B.1.617.2 (India), His-Tag
• Biozol Catalog Number: TRZ-P2020-060_1000
• Supplier Catalog Number: P2020-060_1000
• Alternative Catalog Number: TRZ-P2020-060_1000
• Manufacturer: trenzyme
• Category: Biochemikalien
• Species Reactivity: Virus
• Alternative Names: sars-cov-2

Product Description

The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process. The target protein is also a major immunogen and a possible target for entry inhibitors. The SARS-CoV-2 spike (S) protein is a large type I transmembrane protein composed of two subunits, S1 and S2. The S1 subunit contains a receptor-binding domain (RBD) responsible for binding to the host cell receptor angiotensin-converting enzyme 2 (ACE2). Several mutants of the spike protein are known. A new SARS-CoV-2 lineage called B.1.617, exhibits 13 mutations. Compared to the previously circulating variants, the mutations L452R and T478K of the SARS-CoV-2 Spike S1 (RBD) may cause a stronger affinity of the spike protein to hACE2 and also conferring an increasing ability to evade the hosts’ immune system.

Product Properties

• Molecular Weight: 27,6 kDa
• UniProt: P0DTC2
• Buffer: PBS
• Purity: > 75% as determined by SDS-PAGE
• Form: liquid
• Sequence: MRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTF KCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWN SNNLDSKVGGNYNYRYRLFRKSNLKPFERDISTEIYQAGSKPCNGVEGFNCYFPLQSYGF QPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
• Formula: pH 7,4

Images

Structural model of SARS-CoV-2 S1 (RBD) Delta B.1.617.2 (India) His-Tag

Histogram of SARS-CoV-2 S1 (RBD) Delta B.1.617.2 (India) His-Tag

SDS-Page of SARS-CoV-2 S1 (RBD) Delta B.1.617.2 (India) His-Tag