hGuanylatekinase, His-Tag

Artikelnummer: TRZ-P2020-107_1000
Artikelname: hGuanylatekinase, His-Tag
Artikelnummer: TRZ-P2020-107_1000
Hersteller Artikelnummer: P2020-107_1000
Alternativnummer: TRZ-P2020-107_1000
Hersteller: trenzyme
Kategorie: Biochemikalien
Applikation: ELISA, FA, WB
Spezies Reaktivität: Human
Alternative Synonym: guanosine monophosphate kinase, GMK, GMPK, Guanylate kinase, GUK1, hGMPK, human Guanylate kinase, GMP Kinase
Human Guanylate kinase is the only known enzyme which catalyzes the ATP-dependant phosphorylation of cellular guanosine monophosphate kinase (GMP) into guanosine monophosphate kinase (GDP). Process is crucial for GMP and cyclic guanosine monophosphate (c
Molekulargewicht: 24,1 kDa
UniProt: Q16774
Puffer: PBS
Reinheit: > 95% as determined by SDS-PAGE
Formulierung: liquid
Sequenz: MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA
Formel: pH 7,4
SDS-Page of hGuanylatkinase His-Tag
Structural model of hGuanylatkinase His-Tag
Histogram of hGuanylatkinase His-Tag