hGuanylatekinase, His-Tag

Catalog Number: TRZ-P2020-107_1000
Article Name: hGuanylatekinase, His-Tag
Biozol Catalog Number: TRZ-P2020-107_1000
Supplier Catalog Number: P2020-107_1000
Alternative Catalog Number: TRZ-P2020-107_1000
Manufacturer: trenzyme
Category: Biochemikalien
Application: ELISA, FA, WB
Species Reactivity: Human
Alternative Names: guanosine monophosphate kinase, GMK, GMPK, Guanylate kinase, GUK1, hGMPK, human Guanylate kinase, GMP Kinase
Human Guanylate kinase is the only known enzyme which catalyzes the ATP-dependant phosphorylation of cellular guanosine monophosphate kinase (GMP) into guanosine monophosphate kinase (GDP). Process is crucial for GMP and cyclic guanosine monophosphate (c
Molecular Weight: 24,1 kDa
UniProt: Q16774
Buffer: PBS
Purity: > 95% as determined by SDS-PAGE
Form: liquid
Sequence: MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA
Formula: pH 7,4
SDS-Page of hGuanylatkinase His-Tag
Structural model of hGuanylatkinase His-Tag
Histogram of hGuanylatkinase His-Tag