pro-activin A, GFP/His-tag, Human

Artikelnummer: TRZ-P2020-121_100
Artikelname: pro-activin A, GFP/His-tag, Human
Artikelnummer: TRZ-P2020-121_100
Hersteller Artikelnummer: P2020-121_100
Alternativnummer: TRZ-P2020-121_100
Hersteller: trenzyme
Wirt: Human
Kategorie: Biochemikalien
Applikation: ELISA, FA, WB
Spezies Reaktivität: Human
Alternative Synonym: Activin beta-A chain, Erythroid differentiation protein (EDF), latent Activin A protein, inhibin beta A chain, inhibin beta A subunit
Activin A belongs to the TGF-beta superfamily of cytokines and is a disulfide-linked homodimer consisting of four inhibin betaA chains. Any acitivin is expressed as latent complex, in which the pro-domain of activin is noncovalently linked to the mature,
Molekulargewicht: 73,3 kDa
UniProt: P08476
Puffer: PBS
Reinheit: > 95% as determined by SDS-PAGE
Formulierung: liquid
Sequenz: MSPTPGSEGHSAAPDCPSCALAALPKDVPNSQPEMVEAVKKHILNMLHLKKRPDVTQPVP KAALLNAIRKLHVGKVGENGYVEIEDDIGRRAEMNELMEQTSEIITFAESGTARKTLHFE ISKEGSDLSVVERAEVWLFLKVPKANRTRTKVTIRLFQQQKHPQGSLDTGEEAEEVGLKG ERSELLLSEKVVDARKSTWHVFPVSSSIQRLLDQGKSSLDVRIACEQCQESGASLVLLGK KKKKEEEGEG
Formel: pH 7,4
SDS-Page of pro-activin A GFP/His-tag
Structural model of pro-activin A GFP/His-tag
Histogram of pro-activin A GFP/His-tag