pro-activin A, GFP/His-tag, Human

Catalog Number: TRZ-P2020-121_100
Article Name: pro-activin A, GFP/His-tag, Human
Biozol Catalog Number: TRZ-P2020-121_100
Supplier Catalog Number: P2020-121_100
Alternative Catalog Number: TRZ-P2020-121_100
Manufacturer: trenzyme
Host: Human
Category: Biochemikalien
Application: ELISA, FA, WB
Species Reactivity: Human
Alternative Names: Activin beta-A chain, Erythroid differentiation protein (EDF), latent Activin A protein, inhibin beta A chain, inhibin beta A subunit
Activin A belongs to the TGF-beta superfamily of cytokines and is a disulfide-linked homodimer consisting of four inhibin betaA chains. Any acitivin is expressed as latent complex, in which the pro-domain of activin is noncovalently linked to the mature,
Molecular Weight: 73,3 kDa
UniProt: P08476
Buffer: PBS
Purity: > 95% as determined by SDS-PAGE
Form: liquid
Sequence: MSPTPGSEGHSAAPDCPSCALAALPKDVPNSQPEMVEAVKKHILNMLHLKKRPDVTQPVP KAALLNAIRKLHVGKVGENGYVEIEDDIGRRAEMNELMEQTSEIITFAESGTARKTLHFE ISKEGSDLSVVERAEVWLFLKVPKANRTRTKVTIRLFQQQKHPQGSLDTGEEAEEVGLKG ERSELLLSEKVVDARKSTWHVFPVSSSIQRLLDQGKSSLDVRIACEQCQESGASLVLLGK KKKKEEEGEG
Formula: pH 7,4
SDS-Page of pro-activin A GFP/His-tag
Structural model of pro-activin A GFP/His-tag
Histogram of pro-activin A GFP/His-tag