AGMAT (Agmatinase, Mitochondrial, Agmatine Ureohydrolase, AUH, FLJ23384), Mouse

Artikelnummer: USB-123058
Artikelname: AGMAT (Agmatinase, Mitochondrial, Agmatine Ureohydrolase, AUH, FLJ23384), Mouse
Artikelnummer: USB-123058
Hersteller Artikelnummer: 123058
Alternativnummer: USB-123058-50
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: WB
Immunogen: Full length human AGMAT, aa1-352 (AAH05090.1).
Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLRLLASGCARGPGPGVGARPAAGLFHPGRRQSRQASDAPRNQPPSPEFVARPVGVCSMMRLPVQTSPEGLDAAFIGVPLDTGTSN
NCBI: 005090
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2.