AGMAT (Agmatinase, Mitochondrial, Agmatine Ureohydrolase, AUH, FLJ23384), Mouse

Product Overview

• Article Name: AGMAT (Agmatinase, Mitochondrial, Agmatine Ureohydrolase, AUH, FLJ23384), Mouse
• Biozol Catalog Number: USB-123058
• Supplier Catalog Number: 123058
• Alternative Catalog Number: USB-123058-50
• Manufacturer: US Biological
• Host: Mouse
• Category: Antikörper
• Application: WB
• Immunogen: Full length human AGMAT, aa1-352 (AAH05090.1).

Product Description

Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLRLLASGCARGPGPGVGARPAAGLFHPGRRQSRQASDAPRNQPPSPEFVARPVGVCSMMRLPVQTSPEGLDAAFIGVPLDTGTSN

Product Properties

• NCBI: 005090
• Purity: Purified by Protein A affinity chromatography.
• Form: Supplied as a liquid in PBS, pH 7.2.