TAGLN (Transgelin, 22kD Actin-binding Protein, Protein WS3-10, Smooth Muscle Protein 22-alpha, SM22-alpha, SM22, WS3-10, DKFZp686P11128), Clone: [1E2], Mouse, Monoclonal

Artikelnummer: USB-134203
Artikelname: TAGLN (Transgelin, 22kD Actin-binding Protein, Protein WS3-10, Smooth Muscle Protein 22-alpha, SM22-alpha, SM22, WS3-10, DKFZp686P11128), Clone: [1E2], Mouse, Monoclonal
Artikelnummer: USB-134203
Hersteller Artikelnummer: 134203
Alternativnummer: USB-134203-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, WB
Immunogen: Full length recombinant corresponding to aa1-202 from human TAGLN (AAH04927) with GST tag. MW of the GST tag alone is 26kD.
TAGLN (Transgelin), otherwise known as SM22-alpha, a shape change sensitive, actin cross-linking/gelling protein, and member of the calponin family, which plays a role in calcium interactions and contractile properties of the cell. TAGLN is ubiquitously expressed by vascular and visceral smooth muscle, and an early marker of smooth muscle differentiation, and also overexpressed by senescent human fibroblasts. Studies have identified TAGLN as a novel tumor suppressor protein, which has a markedly reduced expression in colorectal cancer samples, and may serve as an important biomarker of malignancy. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Klonalität: Monoclonal
Klon-Bezeichnung: [1E2]
NCBI: 004927
UniProt: Q01995
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2.