TAGLN (Transgelin, 22kD Actin-binding Protein, Protein WS3-10, Smooth Muscle Protein 22-alpha, SM22-alpha, SM22, WS3-10, DKFZp686P11128), Clone: [1E2], Mouse, Monoclonal

Product Overview

• Article Name: TAGLN (Transgelin, 22kD Actin-binding Protein, Protein WS3-10, Smooth Muscle Protein 22-alpha, SM22-alpha, SM22, WS3-10, DKFZp686P11128), Clone: [1E2], Mouse, Monoclonal
• Biozol Catalog Number: USB-134203
• Supplier Catalog Number: 134203
• Alternative Catalog Number: USB-134203-100
• Manufacturer: US Biological
• Host: Mouse
• Category: Antikörper
• Application: ELISA, WB
• Immunogen: Full length recombinant corresponding to aa1-202 from human TAGLN (AAH04927) with GST tag. MW of the GST tag alone is 26kD.

Product Description

TAGLN (Transgelin), otherwise known as SM22-alpha, a shape change sensitive, actin cross-linking/gelling protein, and member of the calponin family, which plays a role in calcium interactions and contractile properties of the cell. TAGLN is ubiquitously expressed by vascular and visceral smooth muscle, and an early marker of smooth muscle differentiation, and also overexpressed by senescent human fibroblasts. Studies have identified TAGLN as a novel tumor suppressor protein, which has a markedly reduced expression in colorectal cancer samples, and may serve as an important biomarker of malignancy. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Product Properties

• Clonality: Monoclonal
• Clone Designation: [1E2]
• NCBI: 004927
• UniProt: Q01995
• Purity: Purified by Protein A affinity chromatography.
• Form: Supplied as a liquid in PBS, pH 7.2.