USP15 (Ubiquitin-specific-processing Protease 15, Ubiquitin Carboxyl-terminal Hydrolase 15, Deubiquitinating Enzyme 15, Ubiquitin Thioesterase 15, Unph-2, Unph4, KIAA0529), Clone: [1C10], Mouse, Monoclonal

Produktübersicht

• Artikelname: USP15 (Ubiquitin-specific-processing Protease 15, Ubiquitin Carboxyl-terminal Hydrolase 15, Deubiquitinating Enzyme 15, Ubiquitin Thioesterase 15, Unph-2, Unph4, KIAA0529), Clone: [1C10], Mouse, Monoclonal
• Artikelnummer: USB-135152
• Hersteller Artikelnummer: 135152
• Alternativnummer: USB-135152-100
• Hersteller: US Biological
• Wirt: Mouse
• Kategorie: Antikörper
• Applikation: ELISA, IF, WB
• Immunogen: Full length protein corresponding to aa1-235 from USP15 (AAH20688) with GST tag. MW of the GST tag alone is 26kD.

Produktbeschreibung

Applications: Suitable for use in ELISA, Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MAEGGAADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGPIDNSGLLKDGDAQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQGMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFSIPDEKETRLWNKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGTWPRGPSTPKKPLEQSC Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [1C10]
• NCBI: 020688
• Reinheit: Purified by Protein A affinity chromatography.
• Formulierung: Supplied as a liquid in PBS, pH 7.2.