USP15 (Ubiquitin-specific-processing Protease 15, Ubiquitin Carboxyl-terminal Hydrolase 15, Deubiquitinating Enzyme 15, Ubiquitin Thioesterase 15, Unph-2, Unph4, KIAA0529), Clone: [1C10], Mouse, Monoclonal

Catalog Number: USB-135152
Article Name: USP15 (Ubiquitin-specific-processing Protease 15, Ubiquitin Carboxyl-terminal Hydrolase 15, Deubiquitinating Enzyme 15, Ubiquitin Thioesterase 15, Unph-2, Unph4, KIAA0529), Clone: [1C10], Mouse, Monoclonal
Biozol Catalog Number: USB-135152
Supplier Catalog Number: 135152
Alternative Catalog Number: USB-135152-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA, IF, WB
Immunogen: Full length protein corresponding to aa1-235 from USP15 (AAH20688) with GST tag. MW of the GST tag alone is 26kD.
Applications: Suitable for use in ELISA, Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MAEGGAADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGPIDNSGLLKDGDAQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQGMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFSIPDEKETRLWNKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGTWPRGPSTPKKPLEQSC Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Clonality: Monoclonal
Clone Designation: [1C10]
NCBI: 020688
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2.