NELL2 (Protein Kinase C-binding Protein NELL2, NEL-like Protein 2, Nel-related Protein 2, NRP2) (APC), Rabbit

Artikelnummer: USB-138174-APC
Artikelname: NELL2 (Protein Kinase C-binding Protein NELL2, NEL-like Protein 2, Nel-related Protein 2, NRP2) (APC), Rabbit
Artikelnummer: USB-138174-APC
Hersteller Artikelnummer: 138174-APC
Alternativnummer: USB-138174-APC-100
Hersteller: US Biological
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: Synthetic peptide corresponding to MESRVLLRTFCLIFGLGAVWGLGVDPSLQIDVLTELELGESTTGVRQVPG
NELL2 is a cytoplasmic protein that contains epidermal growth factor (EGF) -like repeats. Heterotrimeric protein may be involved in cell growth regulation and differentiation. A similar protein in rodents is involved in craniosynostosis. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 5ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).