NELL2 (Protein Kinase C-binding Protein NELL2, NEL-like Protein 2, Nel-related Protein 2, NRP2) (APC), Rabbit

Catalog Number: USB-138174-APC
Article Name: NELL2 (Protein Kinase C-binding Protein NELL2, NEL-like Protein 2, Nel-related Protein 2, NRP2) (APC), Rabbit
Biozol Catalog Number: USB-138174-APC
Supplier Catalog Number: 138174-APC
Alternative Catalog Number: USB-138174-APC-100
Manufacturer: US Biological
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: Synthetic peptide corresponding to MESRVLLRTFCLIFGLGAVWGLGVDPSLQIDVLTELELGESTTGVRQVPG
NELL2 is a cytoplasmic protein that contains epidermal growth factor (EGF) -like repeats. Heterotrimeric protein may be involved in cell growth regulation and differentiation. A similar protein in rodents is involved in craniosynostosis. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 5ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).