BAZ1B, Recombinant, Human, aa1335-1450, GST-tag (Bromodomain Adjacent to Zinc Finger Domain 1B, WBSCR9, WBSCR10, HWALp, WSTF)

Produktübersicht

• Artikelname: BAZ1B, Recombinant, Human, aa1335-1450, GST-tag (Bromodomain Adjacent to Zinc Finger Domain 1B, WBSCR9, WBSCR10, HWALp, WSTF)
• Artikelnummer: USB-298331
• Hersteller Artikelnummer: 298331
• Alternativnummer: USB-298331-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

This gene encodes a member of the bromodomain protein family. The bromodomain is a structural motif characteristic of proteins involved in chromatin-dependent regulation of transcription. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23. [provided by RefSeq, Jul 2008] Source: Recombinant protein corresponding to aa1335-1450 from human BAZ1B, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~40.5kD AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK VDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLV CFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSKRSSR RQSLELQKCEEILHKIVKYRFSWPFREPVTRDEAEDYYDVITHPMDFQTVQNKCSCGS YRSVQEFLTDMKQVFTNAEVYNCRGSHVLSCMVKTEQCLVALLHKHLPGHPYV Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Produkteigenschaften

• Molekulargewicht: 40.5
• NCBI: 032408
• UniProt: Q9UIG0
• Reinheit: Purified (~80%)
• Formulierung: Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 0.04% Tween 20, 20% glycerol.