BAZ1B, Recombinant, Human, aa1335-1450, GST-tag (Bromodomain Adjacent to Zinc Finger Domain 1B, WBSCR9, WBSCR10, HWALp, WSTF)

Catalog Number: USB-298331
Article Name: BAZ1B, Recombinant, Human, aa1335-1450, GST-tag (Bromodomain Adjacent to Zinc Finger Domain 1B, WBSCR9, WBSCR10, HWALp, WSTF)
Biozol Catalog Number: USB-298331
Supplier Catalog Number: 298331
Alternative Catalog Number: USB-298331-100
Manufacturer: US Biological
Category: Molekularbiologie
This gene encodes a member of the bromodomain protein family. The bromodomain is a structural motif characteristic of proteins involved in chromatin-dependent regulation of transcription. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23. [provided by RefSeq, Jul 2008] Source: Recombinant protein corresponding to aa1335-1450 from human BAZ1B, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~40.5kD AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK VDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLV CFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSKRSSR RQSLELQKCEEILHKIVKYRFSWPFREPVTRDEAEDYYDVITHPMDFQTVQNKCSCGS YRSVQEFLTDMKQVFTNAEVYNCRGSHVLSCMVKTEQCLVALLHKHLPGHPYV Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight: 40.5
NCBI: 032408
UniProt: Q9UIG0
Purity: Purified (~80%)
Form: Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 0.04% Tween 20, 20% glycerol.